PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_373BDBA94.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 299aa    MW: 33337.9 Da    PI: 7.2189
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_373BDBA94.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.87e-5651301128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeel+++yL +kv++ ++ + ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgk
  Traes_4BS_373BDBA94.1   5 LPPGFRFHPTDEELITYYLSRKVSDFSFVT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATESGYWKTTGK 91 
                            79*************************988.89***************999999********************************** PP

                    NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            dke+++  g+lvg+kktLvfy grapkgekt+Wvmheyr+
  Traes_4BS_373BDBA94.1  92 DKEIFH-AGRLVGMKKTLVFYGGRAPKGEKTSWVMHEYRI 130
                            ******.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-643151IPR003441NAC domain
PROSITE profilePS5100560.1615151IPR003441NAC domain
PfamPF023652.3E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELIT YYLSRKVSDF SFVTRAIADV DLNKCEPWDL PSKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TESGYWKTTG KDKEIFHAGR LVGMKKTLVF YGGRAPKGEK  120
TSWVMHEYRI QNKFPYKPNK EEWVVCRVFK KSQIVKMRHP QDSPDMDSPC NDGHASLGEL  180
GEIDVSSMLG SFAPTGANAS GDNFGHRIDM GAYMNWLAAA NQGAAAMLPW AAAAAPGLLG  240
TVFSANPAMH KALAPFAGCS QLPRDVGGDA LFGNAMAKVD MECEQPPQLE MHESTWRTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-56515217166NO APICAL MERISTEM PROTEIN
1ut4_B1e-56515217166NO APICAL MERISTEM PROTEIN
1ut7_A1e-56515217166NO APICAL MERISTEM PROTEIN
1ut7_B1e-56515217166NO APICAL MERISTEM PROTEIN
3swm_A1e-56515220169NAC domain-containing protein 19
3swm_B1e-56515220169NAC domain-containing protein 19
3swm_C1e-56515220169NAC domain-containing protein 19
3swm_D1e-56515220169NAC domain-containing protein 19
3swp_A1e-56515220169NAC domain-containing protein 19
3swp_B1e-56515220169NAC domain-containing protein 19
3swp_C1e-56515220169NAC domain-containing protein 19
3swp_D1e-56515220169NAC domain-containing protein 19
4dul_A1e-56515217166NAC domain-containing protein 19
4dul_B1e-56515217166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562269.11e-179PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotO040178e-78NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLW5EA410.0W5EA41_WHEAT; Uncharacterized protein
STRINGMLOC_68284.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.18e-95NAC domain containing protein 58
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]